IGF1-LR3 1mg
$59.00
Stock: 291; Model: IGF1-LR3 1mg; Molecular Formula: C400H625N111O115S9; SKU: IGFLR-022; Research Only: Yes; Products Sold: 23843; Product Views: 161352
IGF LR3 (Long arginine 3-IGF-1) 1mg – High-Quality Research Peptide Long arginine 3-IGF-1 (IGF-1 LR3), offered at 1mg, is a high-quality specialised research peptide developed for advanced scientific exploration in biochemistry and related fields. This product is ideal for laboratory settings where precision and reliability are paramount. Product Name: IGF LR3 1mg Catalogue Number: IGF1LR3-1mg Molecular Formula: C400H625N111O115S9 Molecular Weight: 9117.60 g/mol Purity: ≥98% Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Form: Lyophilised Solid Usage and Storage: Long arginine 3-IGF-1 (IGF-1 LR3) is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines. Synthesis and Quality Assurance: Long arginine 3-IGF-1 (IGF-1 LR3) is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require. Legal and Safety Information: UK-Peptides proudly provides Long arginine 3-IGF-1 (IGF-1 LR3) strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including Long arginine 3-IGF-1 (IGF-1 LR3), are not designed for human consumption or clinical application. If you require high-quality Long arginine 3-IGF-1 (IGF-1 LR3) for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.
MAECENAS IACULIS
Vestibulum curae torquent diam diam commodo parturient penatibus nunc dui adipiscing convallis bulum parturient suspendisse parturient a.Parturient in parturient scelerisque nibh lectus quam a natoque adipiscing a vestibulum hendrerit et pharetra fames nunc natoque dui.
ADIPISCING CONVALLIS BULUM
- Vestibulum penatibus nunc dui adipiscing convallis bulum parturient suspendisse.
- Abitur parturient praesent lectus quam a natoque adipiscing a vestibulum hendre.
- Diam parturient dictumst parturient scelerisque nibh lectus.
Scelerisque adipiscing bibendum sem vestibulum et in a a a purus lectus faucibus lobortis tincidunt purus lectus nisl class eros.Condimentum a et ullamcorper dictumst mus et tristique elementum nam inceptos hac parturient scelerisque vestibulum amet elit ut volutpat.
